.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ras

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted transcriptional regulator of TetR/AcrR family (YP_495839.1) from Novosphingobium aromaticivorans DSM 12444 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2ras Target Id 376219
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS1669,YP_495839.1, 335915 Molecular Weight 23710.57 Da.
    Residues 211 Isoelectric Point 4.68
    Sequence massgtehdamrarlvdvaqaiveerggagltlselaaragisqanlsryfetredlmeaiadywfhpm veimedvlasdlpprrkmyeffarrfvvmrrkweadpvklqtyievgndyfeqvrsyidladhylgeii geamsdgafsglevdetislvnqmcapycalntmttfmerlsedklarivdavfdglsaqdrgarsltg lraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.206
    Matthews' coefficent 2.64 Rfactor 0.177
    Waters 353 Solvent Content 53.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ras
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of bovine lipoyltransferase in complex with lipoyl-AMP
    K Fujiwara, H Hosaka, M Matsuda - Journal of molecular , 2007 - Elsevier
     
    3. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     

    Protein Summary

    Gene Saro_0558 from Novosphingobium aromaticivorans dsm 12444 encodes the YP_495839 protein, a predicted transcriptional regulator from the TetR/AcrR family (PF00440). Analysis of its genome context predicts a likely functional association (score 0.6) with its neighbor Saro_0559, a 5'-nucleotidase.

    Pre-SCOP classifies 2ras in the all alpha class, homeodomain-like superfamily, tetracyclin repressor-like N-terminal domain family. Similar to other members of this family, the 2ras structure can be divided into an N-terminal HTH fold, which likely binds DNA and a C-terminal regulatory domain. No biologically relevant ligand was found bound at the regulatory domain.  A search using DALI for structures similar to 2ras returns as top hits the transcriptional regulator PKSA-related PDB:2gfn (Z=14),  and several uncharacterized HTH transcriptional regulators (Z=13) like PDB:3crj, PDB:2dg8, PDB:1vi0.

    Another related TetR-like structure is the protein Saro_1072 from Novosphingobium aromaticivorans dsm 12444 determined by JCSG (2QTQ). There are significant conformational differences between the structures of 2RAS and 2QTQ.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch