.
The Open Protein Structure Annotation Network
PDB Keyword
.

2raf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative dinucleotide-binding oxidoreductase (NP_786167.1) from Lactobacillus plantarum at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2raf Target Id 376078
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1665,NP_786167.1, 92375 Molecular Weight 20393.11 Da.
    Residues 190 Isoelectric Point 5.02
    Sequence meitifgkgnmgqaighnfeiaghevtyygskdqattlgeivimavpypalaalakqyatqlkgkivvd itnplnfdtwddlvvpadssaaqelqqqlpdsqvlkafnttfaatlqsgqvngkepttvlvagnddsak qrftraladsplevkdagklkrareleamgfmqmtlaaseqigwtggfavvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.186
    Matthews' coefficent 2.06 Rfactor 0.151
    Waters 619 Solvent Content 40.29

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene lp_2792 from Lactobacillus plantarum encodes the NP_786167 protein, a putative dinucleotide-binding oxidoreductase (PF03807).  2raf has a Rossman fold and is structurally similar to oxidoreductases (such as 1jay, 1jax, and 2o3j).  1jay was solved bound to NADP and F420 which is a flavin analogue that can be either oxidized or reduced.  In 1jay, the following residues are in contact with F420: Val98, Thr192, Ile195, Leu196, Met199, and Leu207.  These F420-binding residues correspond to the following residues in the 2raf structure: Asn72, Gly168, Gln171, Met172, Ala175, and Thr183.  A superimposition of 1jayA with chain A of 2raf is shown below.  The F420 binding residues are highlighted in orange.  Aligned residues are blue.  Unaligned residues are colored gray.

     

    In 1jay, the following residues are in contact with NADP: Thr9, Leu12, Ser31, Arg32, Ile135, and Ala137.  These NADP-binding residues correspond to the following residues in 2raf: Lys8, Met11, Gly30, Ser31, Thr110, and Ala112.  A superimposition of 1jayA with chain A of 2raf is shown below.  The NADP binding residues are highlighted in green.  Aligned residues are blue.  Unaligned residues are colored gray.

     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch