.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ra9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal transduction. Acta Crystallogr.,Sect.F 66 1218-1225 2010
    Site JCSG
    PDB Id 2ra9 Target Id 380281
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS1753,YP_001050848.1, PF06938 Molecular Weight 16799.23 Da.
    Residues 149 Isoelectric Point 4.92
    Sequence qhtlkqfaadsalttttplcsevplfdinalgdwtylgtslpakfaklfasilhciddeyflitpvekv rvqvedapllivdferaqphsllnvstsigtlhhnvdikqmkltddsvylplerglwgklgracyynfv nefnlsdlneq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.196
    Matthews' coefficent 2.59 Rfactor 0.162
    Waters 231 Solvent Content 52.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ra9
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural classification of proteins and structural genomics: new insights into protein folding and evolution
    A Andreeva, AG Murzin - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain
    Q Xu, A Bateman, RD Finn, P Abdubek - Journal of molecular , 2010 - Elsevier
     
    5. Structures of the first representatives of Pfam family PF06938 (DUF1285) reveal a new fold with repeated structural motifs and possible involvement in signal
    GW Han, C Bakolitsa, MD Miller, A Kumar - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The Sbal_2486 gene from Shewanella baltica encodes the YP_001050848 protein, a member of the protein family PF06938 (DUF1285), which is an uncharacterized family of bacterial proteins (COG3816). Sbal_2486 (PDB id: 2ra9) and SPO0140 (PDB id: 2re3) provide the first structural representatives of this family. Sbal_2486 genomic context analysis (Sbal_2485, transcriptional regulator, MarR family; Sbal_2487, FAD-linked oxidase domain protein; Sbal_1620, ATP-binding domain (DUF463)) indicates a possible functional association with nucleic acids. See SPO0140 entry for more details.

    The 2ra9 structure reveals a PH-like domain. According to DALI, 2ra9 shows structural similarity to 2re3 (Z=13), and very weakly hit with proteins that bind DNA or RNA (1prk, 1l3a, 2gia) or negatively charged oligosaccharides  (PDB:1plf; Z=2).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch