.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r6v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of FMN-binding protein (NP_142786.1) from Pyrococcus horikoshii at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2r6v Target Id 375048
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS1644,NP_142786.1, 2.30.110.10, 383073 Molecular Weight 19347.53 Da.
    Residues 172 Isoelectric Point 9.03
    Sequence megyrllypmrtylivsghgeetnvmaadwvtvvsfdpfivgvavapkrtthklikkygefvisvpsld vlrdvwiagtkkgpsklkemsvtlipskkvkvpsieealaniecrvidarsygdhtffvgevvgytykd yafekgkpnlkakflahvswsefvtfsekvhkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.154
    Matthews' coefficent 1.88 Rfactor 0.127
    Waters 212 Solvent Content 34.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r6v
    1. Autoindexing with outlier rejection and identification of superimposed lattices
    NK Sauter, BK Poon - Journal of Applied Crystallography, 2010 - scripts.iucr.org
     
    2. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     

    Protein Summary

    The PH0856 gene from Pyrococcus horikoshii encodes a flavin reductase like domain (PF01613, COG1853) that adopts a split barrel-like fold and shows strong similarity to a flavoredoxin from Desulfovibrio vulgaris (PDB id: 2D5M, FATCAT P-value 1.15e-11 with rmsd 2.17 Å over 172 residues, sequence identity 19.8%) and a putative styrene monooxygenase from Thermus thermophilus (PDB id: 1USC, FATCAT P-value 1.47e-11 with rmsd 2.37 Å over 172 residues, sequence identity 19.8%). For more information on the structure and ligand binding properties of the epoxidase (FMN-containing) domain of styrene monooxygenase see [Ref]

     

    To do: compare with PDB id 3IHM (coordinates currently on hold).

     

    This protein shares sequence similarity with 375043 which has more annotation.

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch