.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r4i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of NTF2-like protein of unknown function (YP_678039.1) from Cytophaga hutchinsonii ATCC 33406 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2r4i Target Id 378214
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS1714,YP_678039.1, 3.10.450.50, 335679 Molecular Weight 13751.08 Da.
    Residues 122 Isoelectric Point 4.92
    Sequence mnqrdvildcekklltaiqnndveslevllhddllfiipsgetvtketdiaayssgkialravvpsdyi iriihdtvvvsvnieikgeymehtldntfrylrvwklfdgnwkviagsctaig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.199
    Matthews' coefficent 2.32 Rfactor 0.175
    Waters 430 Solvent Content 47.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r4i
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Modeling structural heterogeneity in proteins from X-ray data
    A Dhanik, H Van Den Bedem, A Deacon - Algorithmic Foundation of , 2009 - Springer
     

    Protein Summary

    Gene CHU_1428 from Cytophaga hutchinsonii atcc 33406 encodes the YP_678039 with unknown function. This protein is a genomic neighbour to TolB protein (homologs of TolB forms Tol-Pal complex that spans envelope).

    2r4i classifies inside the alpha+beta class, NT2-like superfamily, CHU142-like family. It crystalizes as an apparent dimer. Dali top hits are with 3fsd (Zscr=20, 33% identical, unknown function in nutrient uptake), 3ksp (Zscr=17, 17%, Calcium/calmodulin-dependent kinase II association domain), and 3cnx (Zscr=15, 14%, putative dehydratase) but several other proteins of unknown function show similar fold and dimeric association.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch