The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative ATPase (YP_676785.1) from Cytophaga hutchinsonii ATCC 33406 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2r44 Target Id 372359
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS1605,YP_676785.1, BIG_581 Molecular Weight 37561.40 Da.
    Residues 330 Isoelectric Point 5.58
    Sequence melksaeekslyyrnkikevidevgkvvvgqkyminrlligictgghillegvpglaktlsvntlaktm dldfhriqftpdllpsdligtmiynqhkgnfevkkgpvfsnfiladevnrspakvqsallecmqekqvt igdttypldnpflvlatqnpveqegtyplpeaqvdrfmmkihltyldkeselevmrrvsnmnfnyqvqk ivskndvleirneinkvtiseslekyiielvfatrfpaeygleaeasyilygastraainlnrvakama ffnnrdyvlpedikevaydilnhriilnyeaeaegistrqiietilrkvnitka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.218
    Matthews' coefficent 2.83 Rfactor 0.184
    Waters 111 Solvent Content 56.47

    Ligand Information


    Google Scholar output for 2r44
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Intersubunit allosteric communication mediated by a conserved loop in the MCM helicase
    ER Barry, JE Lovett, A Costa - Proceedings of the , 2009 - National Acad Sciences
    3. Identification of a putative Chaperone Involved in Stress Resistance and Virulence in Francisella tularensis
    J Dieppedale, D Sobral, M Dupuis, I Dubail - Infection and , 2011 - Am Soc Microbiol
    4. Novel structural and functional insights into the MoxR family of AAA+ ATPases
    KS Wong, WA Houry - Journal of Structural Biology, 2012 - Elsevier

    Protein Summary

    The CHU_0153 (YP_676785.1) gene from Cytophaga hutchinsonii encodes an ATPase family associated with various cellular activities (AAA) PF07726 (72% sequence identity with the homologous enzyme from Algoriphagus sp.).  The enzyme belongs to the class of alpha and beta (a+b) protein and adopts a P-loop containing nucleoside triphosphate hydrolases SCOP52539.  The AAA ATPases superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid activated ATPases. The AAA proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch