.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an uncharacterized protein (ZP_00112478.1) from Nostoc punctiforme PCC 73102 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 2r3s Target Id 375748
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1662,NPUN_22DEC03_CONTIG1_REVISED_GENENPR0239, 103709 Molecular Weight 36420.53 Da.
    Residues 334 Isoelectric Point 5.25
    Sequence mstpspalffntvnayqrsaaikaavelnvftaisqgiessqslaqkcqtsergmrmlcdylviigfmt kqaegyrltsdsamfldrqskfyvgdaiefllspmitngfndltaavlkggtaissegtlspehpvwvq fakamspmmanpaqliaqlvnenkieplkvldisashglfgiavaqhnpnaeifgvdwasvlevakena riqgvasryhtiagsafevdygndydlvllpnflhhfdvatceqllrkiktalavegkvivfdfipnsd ritppdaaafslvmlattpngdaytfaeyesmfsnagfshsqlhslpttqqqvivayk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.228
    Matthews' coefficent 2.69 Rfactor 0.188
    Waters 308 Solvent Content 54.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r3s
    1. Docking Studies and _-Substitution Effects on the Anti-Inflammatory Activity of _-Hydroxy-_-arylpropanoic Acids
    JS Savi_, SP Dilber, BD Markovi_, MT Milenkovi_ - Molecules, 2011 - mdpi.com
     
    2. Taxifolin suppresses UV-induced skin carcinogenesis by targeting EGFR and PI3-K
    N Oi, H Chen, MO Kim, RA Lubet, AM Bode - Cancer Prevention , 2012 - AACR
     

    Protein Summary

    Gene Npun_R0239 from Nostoc punctiforme pcc 73102 encodes the YP_001863968 that belongs to the O-methyltransferase 2 group (PF00891).

    Pre-SCOP classifies the N-terminal domain (1-87) in the all alpha class, winged-helix DNA binding domain superfamily; the C-terminal domain (90-333) belongs to the alpha/beta class, S-adenosyl-L-methionine dependent methyltransferases superfamily. According to DALI, 2r3s shows structural similarity to several methyl-transferases (PDB codes: 1tw3 [Z=30], 3i5u [Z=29], 1fpx [Z=28], 2ip2 [Z=26], 1kyz [Z=25]).  In contrast to the glycine rich motif (DxGxG) present in similar methyltransferases, 2r3s has the "DISAS" sequence motif. 2r3s crystallizes as an homodimer.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch