.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r3b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative kinase in the ribokinase-like superfamily from Enterococcus faecalis V583 (NP_815490.1) at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2r3b Target Id 375213
    Related PDB Ids 2r3e 
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS1654,NP_815490.1, 3.40.1190.20, 285318 Molecular Weight 31721.70 Da.
    Residues 291 Isoelectric Point 6.75
    Sequence mrylskdileevitqrpsdsyksnfgrvvliggnrqyggaiimsteacinsgaglttvitdvknhgplh arcpeamvvgfeetvlltnvveqadviligpglgldataqqilkmvlaqhqkqqwliidgsaitlfsqg nfsltypekvvftphqmewqrlshlpieqqtlannqrqqaklgstivlkshrttifhagepfqntggnp gmatggtgdtlagiiagflaqfkptietiagavylhsligddlaktdyvvlptkisqalptymkkyaqp htapdselleqkrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.183
    Matthews' coefficent 2.90 Rfactor 0.150
    Waters 623 Solvent Content 57.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r3b
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene EF1790 from Enterococcus faecalis v583 encodes the NP_815490 protein, a putative carbohydrate kinase PF01256, and member of the ribokinase-like superfamily.  The enzyme belongs to the class of alpha and beta (a+b) proteins and adopts a  ribokinase-like fold type SCOP53612.  Dali top hits are with 3bgk (Z=43), the carbohydrate kinase 3k5w (Z=28), and the hydroxyethyl-thiazole kinase 1v8a (Z=21). The crystal structure of another putative carbohydrate kinase from Thermotoga maritima is available 2AX3(Z=35).

    The same structure was also solved in a different crystal form (2r3e).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch