The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative acetyltransferase (YP_831484.1) from Arthrobacter sp. FB24 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2r1i Target Id 376331
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS1672,ARTH_26JUL04_CONTIG35_REVISED_GENE1183, 92316 Molecular Weight 18350.34 Da.
    Residues 171 Isoelectric Point 4.71
    Sequence vdagrgaehdeavtsddsasvevprratpadaatvaqmlhdfntefgaptpgtdelasrlshllagedv vvllagepptglavlsfrpnvwypgpvaildelyvrpgrrghrlgsallaascglvrsrggalleinvd gedtdarrfyeargftntepngtepmlyyyrel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.206
    Matthews' coefficent 2.65 Rfactor 0.174
    Waters 303 Solvent Content 53.51

    Ligand Information


    Google Scholar output for 2r1i
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    The Arthr_2002 gene from Arthrobakter sp. FB24 encodes for a GCN5-related N-acetyltransferase. For a detailed description see 2q0y. (The two structures are almost identical, sharing about 19% sequence identity.)

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch