.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative flavin reductase (YP_719437.1) from Haemophilus somnus 129PT at 1.06 A resolution. To be published
    Site JCSG
    PDB Id 2r0x Target Id 375038
    Molecular Characteristics
    Source Haemophilus somnus 129pt
    Alias Ids TPS1642,HSOM_08NOV04_CONTIG98_REVISED_GENE995, 2.30.110.10, 93049 Molecular Weight 17197.55 Da.
    Residues 157 Isoelectric Point 5.92
    Sequence mvevsqfkdamaqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnarayehfvknrvlmv ntltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdceiteikhvgthdilickivdi hqsnaknalvyrnrvyhsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.06 Rfree 0.170
    Matthews' coefficent 1.75 Rfactor 0.141
    Waters 136 Solvent Content 29.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r0x
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Generalized Fragment Picking in Rosetta: Design, Protocols and Applications
    D Gront, DW Kulp, RM Vernon, CEM Strauss, D Baker - PloS one, 2011 - dx.plos.org
     

    Protein Summary

    The HS_1225 gene (also known as ycdH) from Haemophilus somnus 129PT encodes the YP_719437 sequence, a flavin reductase domain containing protein from PF01613.

    Pre-SCOP classifies 2r0x in the all beta class, FMN-binding split barrel superfamily, NADH:FMN oxidoreductase-like family. DALI returns as top hits the 4-hydroxyphenylacetate 3-monooxygenase PDB:3cb0 and PDB:3k86 (Z=26), the flavin reductase PDB:2qck (Z=23), and the PH0856 protein PDB:2r6v (Z=20).

    See the JCSG determined structure 2qck for more information.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch