The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative FMN-dependent nitroreductase (NP_661249.1) from Chlorobium tepidum TLS at 1.15 A resolution. To be published
    Site JCSG
    PDB Id 2r01 Target Id 376232
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS1670,NP_661249.1,, 335875 Molecular Weight 23032.34 Da.
    Residues 209 Isoelectric Point 5.47
    Sequence megslsrgveimklrelvarsrsirrfdehvavndatlrdlvelvcytpsaanrqllrflpvtgadmsd kvfpclkwagyledwpgpepgerpaaalvmlcrnedlpgaacdsgiaaqtimlgaaekelggcivaaid rerlmaslgipdawtvllvialgkpaetvvidqikpgddirywrdkhgihhvpkrqvdellvtaeqlrerg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.15 Rfree 0.165
    Matthews' coefficent 2.02 Rfactor 0.148
    Waters 227 Solvent Content 39.29

    Ligand Information


    Google Scholar output for 2r01
    1. Prediction of protein binding regions in disordered proteins
    B Mszros, I Simon, Z Dosztnyi - PLoS computational biology, 2009 - dx.plos.org
    2. Natively unstructured loops differ from other loops
    A Schlessinger, J Liu, B Rost - PLoS computational biology, 2007 - dx.plos.org
    3. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    4. Loss-of-function fibroblast growth factor receptor-2 mutations in melanoma
    MG Gartside, H Chen, OA Ibrahimi, SA Byron - Molecular Cancer , 2009 - AACR
    5. Structure and site-specific recognition of histone H3 by the PHD finger of human autoimmune regulator
    S Chakravarty, L Zeng, MM Zhou - Structure, 2009 - Elsevier
    6. Transcription elongation past O6-methylguanine by human RNA polymerase II and bacteriophage T7 RNA polymerase
    A Dimitri, JA Burns, S Broyde - Nucleic acids , 2008 - Oxford Univ Press
    7. Structural Comparison of HIV-1 Envelope Spikes with and without the V1/V2 Loop
    G Hu, J Liu, KA Taylor, KH Roux - Journal of virology, 2011 - Am Soc Microbiol
    8. Absolute configurations of spiroiminodihydantoin and allantoin stereoisomers: Comparison of computed and measured electronic circular dichroism spectra
    S Ding, L Jia, A Durandin, C Crean - Chemical research in , 2009 - ACS Publications
    9. Crystal structure of the mucosa-associated lymphoid tissue lymphoma translocation 1 (MALT1) paracaspase region
    WY Jong, PD Jeffrey, JY Ha - Proceedings of the , 2011 - National Acad Sciences
    10. Structural analysis of human immunodeficiency virus type 1 CRF01_AE protease in complex with the substrate p1-p6
    RM Bandaranayake, M Prabu-Jeyabalan - Journal of , 2008 - Am Soc Microbiol
    11. The prohead-I structure of bacteriophage HK97: implications for scaffold-mediated control of particle assembly and maturation
    RK Huang, R Khayat, KK Lee, I Gertsman - Journal of molecular , 2011 - Elsevier
    12. Hydration properties of mechanosensitive channel pores define the energetics of gating
    A Anishkin, B Akitake, K Kamaraju - Journal of Physics: , 2010 - iopscience.iop.org
    13. Defining Substrate and Blocker Activity of Alanine-Serine-Cysteine Transporter 2 (ASCT2) Ligands with Novel Serine Analogs
    T Albers, W Marsiglia, T Thomas, A Gameiro - Molecular , 2012 - ASPET
    JJ Smith, D Jantz, HW Hellinga - US Patent 20,120,030,783, 2012 - freepatentsonline.com
    15. Rationally-designed meganucleases with altered sequence specificity and DNA-binding affinity
    HW Hellinga, JJ Smith, D Jantz - EP Patent 2,368,981, 2011 - freepatentsonline.com
    16. Rationally-designed meganucleases with altered sequence specificity and DNA-binding affinity
    HW Hellinga, JJ Smith, D Jantz - EP Patent 2,360,244, 2011 - freepatentsonline.com
    JJ Smith, D Jantz, HW Hellinga - US Patent 20,120,021,521, 2012 - freepatentsonline.com
    JJ Smith, D Jantz, HW Hellinga - US Patent 20,120,021,520, 2012 - freepatentsonline.com
    19. Rationally-designed meganucleases with altered sequence specificity and DNA-binding affinity
    JJ Smith, D Jantz, HW Hellinga - US Patent 20,120,021,465, 2012 - freepatentsonline.com
    20. Exploring Molecular Mechanisms of Drug Resistance in HIV-1 Protease through Biochemical and Biophysical Studies: A Dissertation
    RM Bandaranayake - 2010 - escholarship.umassmed.edu
    21. Archaeal box C/DsRNP assembly, structure and function
    KT Gagnon Jr - 2007 - books.google.com

    Protein Summary

    The CT0345 gene from Chlorobium tepidum TLS encodes for NP_661249, a member of the nitroreductase (PF00881, cd02062, cl00514) family, one of the largest (>6000 members), broadly distributed (homologs found in bacteria, archea and eukaryotes, including humans) and structurally characterized (>160 structures solved) PFAM families. Nitroreductases and related oxidoreductases utilize FMN (as bound by this structure) as a cofactor to act on nitro-substituted compounds.

    The asymmetric unit of 2r01 contains a monomer but according to Interpro the protein is a dimer in its fully functional form, which is typical for this family. The structure adopts a 3 layer alpha/beta/alpha sandwich nitroreductase-like fold, inside the FMN-dependent nitroreductase-like superfamily, NADH oxidase/falvin reductase family (cf. SCOP and CATH). 2r01 is one of 13 proteins determined by the JCSG PSI (eg. 3ge5 [Z=17], 3gbh [Z=17], 2hay [Z=16], 3e39 [Z=17], 3gag [Z=16], 1vkw [Z=11]) from this family, as part of an in-depth analysis of the extent and patterns of structural divergence in protein families (PSI MEGA-families project).

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch