.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qzc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative TenA-like thiaminase II (NP_343586.1) from Sulfolobus solfataricus at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2qzc Target Id 376189
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1667,NP_343586.1, 335936 Molecular Weight 24785.23 Da.
    Residues 213 Isoelectric Point 6.31
    Sequence msivgnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlralliasskgpidk vtkilnlvfssrdkglethgklyskldisrdvivktgynlinyaytrhlyyyanldwnkflvawtpcmf gysivgdyvidspnevyktwasfyasteykkrieailyaldevsitedllnifinsvrfeigfwdaslr kdptvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.184
    Matthews' coefficent 2.67 Rfactor 0.165
    Waters 312 Solvent Content 54.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qzc
    1. Purification, crystallization and preliminary X-ray diffraction analysis of the thiaminase type II from Staphylococcus aureus
    A Begum, J Drebes, M Perbandt - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The tenA-1 (SSO2206) gene from S. solfataricus encodes the NP_343586.1 sequence that belongs to the transcriptional activator tenA/thiamine biosynthesis THI-4 family (PF03070). Based on gene fusion and co-ocurrence events, STRING provides a 0.84 hit with thiD-1 phosphomethyl pyrimidine kinase (NP_341579). 

     

    SCOP classifies 2qzc in the all-alpha class, heme oxygenase-like superfamily, TENA/THI-4 family. The crystal structure contains a molecule of imidazole per chain chelated by residues D47 and E198. High structural similarity (FFAS scr=-87; SSM 89%; Dali Z-scr=25; FATCAT P-val=5e-15) is observed with PDB:1udd [Ref], and PDB:2gm8, both TenA homologues.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch