.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qyv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative Xaa-His dipeptidase (YP_718209.1) from Haemophilus somnus 129PT at 2.11 A resolution. To be published
    Site JCSG
    PDB Id 2qyv Target Id 375116
    Molecular Characteristics
    Source Haemophilus somnus 129pt
    Alias Ids TPS1648,YP_718209.1, 3.40.630.10, 452590 Molecular Weight 53629.44 Da.
    Residues 486 Isoelectric Point 5.25
    Sequence msdlqslqpkllwqwfdqicaiphpsykeeqlaqfiinwaktkgffaerdevgnvlirkpatvgmenrk pvvlqahldmvpqanegtnhnfdqdpilpyidgdwvkakgttlgadngigmasalavlesndiahpele vlltmteergmegaiglrpnwlrseilintdteengeiyigcaggenadlelpieyqvnnfehcyqvvl kglrgghsgvdihtgranaikvllrflaelqqnqphfdftlanirggsirnaipresvatlvfngditv lqsavqkfadvikaelaltepnliftlekvekpqqvfssqctkniihclnvlpngvvrnsdvienvvet slsigvlktednfvrstmlvrsliesgksyvasllkslaslaqgninlsgdypgwepqshsdildltkt iyaqvlgtdpeikvihaglecgllkkiyptidmvsigptirnahspdekvhipavetywkvltgilahipsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.11 Rfree 0.244
    Matthews' coefficent 4.17 Rfactor 0.220
    Waters 466 Solvent Content 70.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qyv
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Autoindexing the diffraction patterns from crystals with a pseudotranslation
    NK Sauter, PH Zwart - Acta Crystallographica Section D: Biological , 2009 - scripts.iucr.org
     
    4. Crystal structure and mutational analysis of aminoacylhistidine dipeptidase from vibrio alginolyticus reveal a new architecture of M20 metallopeptidases
    CY Chang, YC Hsieh, TY Wang, YC Chen - Journal of Biological , 2010 - ASBMB
     
    5. Mutational and structural analysis of LN-carbamoylase: new insights into a peptidase M20/M25/M40 family member.
    S Martnez-Rodrguez, A Garca-Pino - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary

     The HS_0004 gene (also known as pepD) gene (PF01546, cl09126) from Haemophilus somnus 129PT encodes for YP_718209, a zinc metallopeptidase (EC:3.4.13.3). More specifically, this protein is a M20C dipeptidase, hydrolizing the Xaa-His dipeptide.The mixed alpha/beta protein structure can be divided into two domains, one is a 3 layer alpha/beta/alpha sandwich (2qyv-CATH) and the other is a 2 layer alpha/beta sandwich. The functional oligomer is a dimer and about 80 residues of the N-terminus act as a dimerization domain (PF07687). It is interesting to notice that the 2 layer domain of this protein may have become duplicated. Other similar structures determined by PSI include 2rb7, 3gb0, 3ic1, 2pok, and 3isz.

    ToDo: Find out more about this putatively duplicated domain. Also, get some more information if this is changing the interface behavior.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch