| Title | Crystal structure of multiple antibiotic-resistance repressor (MarR) (YP_013417.1) from Listeria monocytogenes 4b F2365 at 2.07 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 371703 | | Molecular Characteristics | | Source | Listeria monocytogenes str. 4b f2365 | | Alias Ids | TPS1589,YP_013417.1 | Molecular Weight | 16796.61 Da. | | Residues | 153 | Isoelectric Point | 9.07 | | Sequence | mvgintdtenisellktywsiqrisagyadqnaaslgltiqqlaminviystpgisvadltkrliitgs saaanvdglislglvvklnktipndsmdltlklskkgedlskrstanafmykammkvfenlteneieel irlnkkvetllkksk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.07 | Rfree | 0.293 | | Matthews' coefficent | 2.47 | Rfactor | 0.239 | | Waters | 333 | Solvent Content | 50.13 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The LMHCC_1836 gene (PF01047, cl00088) from Listeria monocytogenes 4b F2365 encodes for a multiple antibiotic resistance protein from the marR family. Even though the Pfam hit is rather weak, structure similarity to other MarR proteins like 3gfi [Ref] is confirming this annotation. These all-alpha proteins are short (135aa) transcriptional regulators and bind DNA via a winged helix/turn/helix motif (wHTH) as a dimer, with each monomer rbinding to half of a two fold symmetric DNA recognition sequence. Other MarR structures determined by PSI include 2a61, 3bj6, and 1lj9 [Ref].
Ligand Summary
References