.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of multiple antibiotic-resistance repressor (MarR) (YP_013417.1) from Listeria monocytogenes 4b F2365 at 2.07 A resolution. To be published
    Site JCSG
    PDB Id 2qww Target Id 371703
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS1589,YP_013417.1, 91132 Molecular Weight 16796.61 Da.
    Residues 153 Isoelectric Point 9.07
    Sequence mvgintdtenisellktywsiqrisagyadqnaaslgltiqqlaminviystpgisvadltkrliitgs saaanvdglislglvvklnktipndsmdltlklskkgedlskrstanafmykammkvfenlteneieel irlnkkvetllkksk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.07 Rfree 0.293
    Matthews' coefficent 2.47 Rfactor 0.239
    Waters 333 Solvent Content 50.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qww
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The LMHCC_1836 gene (PF01047, cl00088) from Listeria monocytogenes 4b F2365 encodes for a multiple antibiotic resistance protein from the marR family. Even though the Pfam hit is rather weak, structure similarity to other MarR proteins like 3gfi [Ref] is confirming this annotation. These all-alpha proteins are short (135aa) transcriptional regulators and bind DNA via a winged helix/turn/helix motif (wHTH) as a dimer, with each monomer rbinding to half of a two fold symmetric DNA recognition sequence. Other MarR structures determined by PSI include 2a61, 3bj6, and 1lj9 [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch