.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative sugar phosphate isomerase/epimerase (YP_324688.1) from Anabaena variabilis ATCC 29413 at 1.78 A resolution. To be published
    Site JCSG
    PDB Id 2qw5 Target Id 375744
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1661,YP_324688.1, 92328 Molecular Weight 38012.39 Da.
    Residues 334 Isoelectric Point 5.74
    Sequence mtklpatsdiyisffmfttnlqpdnldyrrivvahikklqrfgysgfefpiapglpenyaqdlenytnl rhyldseglenvkistnvgatrtfdpssnypeqrqealeylksrvditaalggeimmgpivipygvfpt tdfnepiwsdelqehlkvryanaqpildklgeyaeikkvklaiepithwetpgpnklsqlieflkgvks kqvgvvidsaheildgegpeifktqveylaqqgrlhyvqvsppdrgalhtswlpwksfltpivkvydgp iaveifnaipaftnslrltrrkfwipdedppnqypnaydiadeaikvtrkelkkigsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.224
    Matthews' coefficent 2.41 Rfactor 0.177
    Waters 690 Solvent Content 48.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qw5
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The Ava_4194 gene (PF01261, COG1082) from Anabaena variabilis ATCC 29413 codes for a xylose isomerase-like TIM barrel. YP_324688 is almost identical to  NP_485623.1 (96% sequence identity over all residues). FIGfam annotates it as a D-tagatose-3-epimerase (EC:5.3.1.-).

    2qw5 Dali top hits (Zscr=30) are with D-tagatose-3-epimerases like 2qum, 2qul, 2ou4, and 2hk1.

    For more information on structure and function of 2qw5, see 2g0w (Zscr=21) and 3cny (Zscr=23). Related structures determined by PSI are 3kws (Zscr=25) and 3ktc (Zscr=24).

    ToDo: Infer more about function from the xylose ligand.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch