.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qtq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted DNA-binding transcriptional regulator (YP_496351.1) from Novosphingobium aromaticivorans DSM 12444 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2qtq Target Id 376212
    Related PDB Ids 2rha 
    Molecular Characteristics
    Source Novosphingobium aromaticivorans dsm 12444
    Alias Ids TPS1930,YP_496351.1, _0018.001261_, 383137 Molecular Weight 24112.22 Da.
    Residues 212 Isoelectric Point 6.21
    Sequence mssdvqkgdnletpgardlllqtasnimregdvvdislselslrsglnsalvkyyfgnkagllkalldr dmenivksvdallakddmspeaklrrhiskcidtyydypylnrllmrlvrdsdeaeakriadqyllplh raynrfigegvkagvfrpinpqlfyftvtgaadrffsarlvlkhcfdqdtlteqlrdsyrehtvdfima gilah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.216
    Matthews' coefficent 2.75 Rfactor 0.185
    Waters 686 Solvent Content 55.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qtq
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The Saro_1072 gene from Novosphingobium aromaticivorans DSM 12444 encodes for the YP_496351 protein which shows weak sequence similarity to transcriptional regulators in archaea and bacteria, including the antibiotics responsive tetR regulatory proteins (PF00440, COG1309).

     

    The protein possesses a classical helix-turn-helix DNA binding motif located in the N-terminus of the protein (see 2qtq-CATH) and has an all alpha topology. 2qtq belongs to the SCOP homeodomain-like superfamily, N-terminal domain tetracyclin repressor-like family. An identical structure solved by PSI is 2rha. According to DALI, 2qtq is structurally similar to transcriptional regulators like PDB:1pb6 (Z=15, topsan), PDB:2gen (Z=13, topsan) PDB:3him (Z=14, topsan), PDB:2nx4 (Z=13, topsan).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (1)

    FileSizeDateAttached by 
    2rha.png
    No description
    24.96 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch