.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qtd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title NMR structure of the protein NP_247299.1: comparison with the crystal structure. Acta Crystallogr.,Sect.F 66 1367-1380 2010
    Site JCSG
    PDB Id 2qtd Target Id 376479
    Related PDB Ids 2kla 
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS1681,NP_247299.1, 103744 Molecular Weight 11896.98 Da.
    Residues 104 Isoelectric Point 5.19
    Sequence minmkvaismdvdkisnsfedckyflivriddnevkstkvifndesgkksivkenvnaiickniseeny kkfskkieiyhaegddvdknislfiegelskisnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.255
    Matthews' coefficent 2.26 Rfactor 0.202
    Waters 65 Solvent Content 45.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qtd
    1. NMR structure of the protein NP_247299. 1: comparison with the crystal structure
    K Jaudzems, M Geralt, P Serrano - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

     Gene MJ0327 from M. jannaschii encodes the NP_247299 amino acid sequence that belongs to the NifX family (PF02579), which contains several iron-molybdenum cofactors (FeMo-co) involved in nitrogen fixation [Ref].

     

    pre-SCOP classifies 2qtd in the alpha/beta class, ribonuclease H-like motif fold, nitrogenase accesory factor-like superfamily, MTH1175-like family. Dali top hits (Zscr=13-11) are with the uncharacterized protein TA1041 PDB:2re2, PDB:1rdu, and the MTH1175 protein PDB:1eo1

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch