.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qr6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of IMP dehydrogenase/GMP reductase-like protein (NP_599840.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2qr6 Target Id 375605
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1657,NP_599840.1, 335816 Molecular Weight 39768.66 Da.
    Residues 374 Isoelectric Point 4.97
    Sequence mrdhveigigrearrtyslddisvvssrrtrsskdvdttwhidaykfdlpfmnhpsdalaspefviemg kqgglgvinaeglwgrhadldeaiakviaayeegdqaaatrtlqelhaapldtellseriaqvrdsgei vavrvspqnvreiapivikagadllviqgtlisaehvntggealnlkefigsldvpviaggvndyttal hmmrtgavgiivgggentnslalgmevsmataiadvaaarrdyldetggryvhiiadgsiensgdvvka iacgadavvlgsplaraeeaagkgyfwpavaahprfprgvvtesvdldeaapsleqilhgpstmpwgve nfegglkralakcgytdlksfqkvslhvn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.188
    Matthews' coefficent 2.60 Rfactor 0.169
    Waters 285 Solvent Content 52.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qr6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Cysteine required for inositol-5-monophosphate dehydrogenase activity is absent at a putative active site (i.e. 'GGGEN---TNS,' where '---' indicates missing active site 'SIC' present in protein structure with PDB code 1zfj).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch