.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qpx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative metal-dependent hydrolase (YP_805737.1) from Lactobacillus casei ATCC 334 at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2qpx Target Id 375624
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS1658,LCAS_20SEP02_SCAFFOLD4_REVISED_GENE2707, 103701 Molecular Weight 42568.20 Da.
    Residues 375 Isoelectric Point 5.65
    Sequence lddlsefvdqvplldhhchflidgkvpnrddrlaqvsteadkdypladtknrlayhgflalakefalda nnplaamndpgyatynhrifghfhfkellidtgfvpddpildldqtaelvgipvkaiyrlethaedfml ehdnfaawwqafsndvkqakahgfvgfksiaayrvglhlepvnvieaaagfdtwkhsgekrltskplid ymlyhvapfiiaqdmplqfhvgygdadtdmylgnpllmrdylkaftkkglkvvllhcypyhreagylas vfpnlyfdislldnlgpsgasrvfneavelapytrilfasdastypemyglaarqfkqalvahfnqlpf vdlaqkkawinaicwqtsaklyhqerelrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.162
    Matthews' coefficent 2.78 Rfactor 0.134
    Waters 494 Solvent Content 55.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qpx
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Reversible post-translational carboxylation modulates the enzymatic activity of N-acetyl-L-ornithine transcarbamylase
    Y Li, X Yu, J Ho, D Fushman, N Allewell - Biochemistry, 2010 - ACS Publications
     

    Protein Summary

    The LSEI_0440 gene (PF04909, cl00281) from Lactobacillus casei ATCC 334 encodes for a protein in a huge metallo-dependent hydrolase family (PF01979). Although current CATH and SCOP do not classify this protein structure, structural similarity to 2pnk allows to insert this TIM barrel structure to the metallo-dependent hydrolases in SCOP. Other similar structures determined by PSI are 2qee and 1j5s.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch