.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qnl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein CHU_0679 (YP_677306.1) from Cytophaga hutchinsonii ATCC 33406 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2qnl Target Id 376375
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS1675,YP_677306.1, 335855 Molecular Weight 18368.97 Da.
    Residues 161 Isoelectric Point 6.65
    Sequence mhtqealfvrlaldawntqssrtdkliqslsnealavetapgrnsgtyllghltavhdamlpllelgdt lypqlapvfiqnpdksglekpeindlrlywslvqerlanqfnqlqpadwfnkhaaisredflkephrnk lsvlinrtnhmayhlgqlaylkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.185
    Matthews' coefficent 2.43 Rfactor 0.159
    Waters 250 Solvent Content 49.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qnl
    1. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The CHU_0679 gene codifies for the YP_677306.1 sequence that belongs to the DNA damage inducible (din) B group (PF05163). It shows the conserved catalytic triad (H52--//--H148---H152) involved in metal (Ni) chelation. Study of its genome context provides a very weak hit (score 0.46) with the DeoR family of transcriptional regulators (YP_677307).

     

    SCOP classifies 2qnl in the all-alpha class, DinB/YfiT-like putative metalloenzymes superfamily, DinB-like family. The highest structural similarity (FFAS scr=-21; Dali Z-scr=14) is observed with 3di5, a putative enzyme with Ni bound and coordinated by a conserved His triad  (H48, H127, H131). A second hit (HHpred P-val=1e-26; FATCAT P-val=1e-8) is with 1rxq, a putative metal dependent hydrolase member of the YfiT family crystallized with Ni bound to positions H67 and H164 together with two ordered water molecules [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch