The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein BH2621 (NP_243487.1) from Bacillus halodurans at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 2qml Target Id 376113
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1666,NP_243487.1, 92713 Molecular Weight 23508.20 Da.
    Residues 197 Isoelectric Point 6.05
    Sequence mkcndklapfevfdhvvnkklsfrhvtmddvdmlhswmheehvipywklniplvdykkhlqtflnddhq tlmvgaingvpmsywesywvkediianyypfeehdqgihlligpqeylgqgliyplllaimqqkfqepd tntivaepdrrnkkmihvfkkcgfqpvkevelpdkigllmkceqnvfekrwsdwkmnkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.212
    Matthews' coefficent 2.39 Rfactor 0.179
    Waters 168 Solvent Content 48.56

    Ligand Information


    Google Scholar output for 2qml
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Refinement of protein termini in template_based modeling using conformational space annealing
    H Park, J Ko, K Joo, J Lee, C Seok - : Structure, Function, and , 2011 - Wiley Online Library

    Protein Summary

    This protein is now in family PF10331.2 AlcB, and there are other structures.


    The BH2621 gene of Bacillus halodurans encodes the protein NP_243487 implicated in alcaligin biosynthesis (PF10331, COG1670 ). The BH2671 structure is a single-domain protein belonging to the Acyl-coA N-acyltransferase fold with structural similarity (1.5 Å main-chain rmsd over 172 residues with 24% sequence identity) to a homolog from Mycobacterium tuberculosis (PDB id: 1yk3 ). See Card 2005 for more information.

    Ligand Summary





    No references found.

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch