.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ql8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative redox protein (YP_805721.1) from Lactobacillus casei ATCC 334 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2ql8 Target Id 376404
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS1676,YP_805721.1, 103675 Molecular Weight 15698.84 Da.
    Residues 142 Isoelectric Point 5.16
    Sequence mqderwnhplytttaindeeleghayipgglkvqtsspmndhpgtnpeqllglslstcleatleaveke hglphtgavrvkvafigaraeyqflvhaqvmvkgvdfdtakaftneienrcpvskllknsgnytietvt dfkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.159
    Matthews' coefficent 3.43 Rfactor 0.135
    Waters 431 Solvent Content 64.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ql8
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The LSEI_0423 gene from Lactobacillus casei atcc 334 encodes the YP_805721 amino acid sequence of an osmotically inducible protein C (OsmC) homolog (PF02566, COG1764).

    According to SCOP, 2ql8 adopts an OsmC-like fold. A DALI search returns hits with the organic hydroperoxide resistance protein 2bjo, 3eer and 1zb9 (Z=16), followed by the OsmC protein 1ukk (Z=13).

    In Thermococcus kodakaraensis kod1, OsmC exhibits significant peroxidase activity that is temperature dependent [Ref]. Homolog structures from Thermus thermophilus [Ref] and Escherichia coli [Ref] also suggest hydroperoxide peroxidase activity.

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch