.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qjw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein XCC1541 (NP_636912.1) from Xanthomonas campestris at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2qjw Target Id 372467
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS1610,NP_636912.1, BIG_556 Molecular Weight 18712.45 Da.
    Residues 175 Isoelectric Point 6.37
    Sequence msrghcilahgfesgpdalkvtalaevaerlgwtherpdftdldarrdlgqlgdvrgrlqrlleiaraa tekgpvvlagsslgsyiaaqvslqvptralflmvpptkmgplpaldaaavpisivhawhdelipaadvi awaqarsarlllvddghrlgahvqaasrafaellqsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.35 Rfree 0.216
    Matthews' coefficent 2.14 Rfactor 0.182
    Waters 767 Solvent Content 42.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qjw
    1. CMASA: an accurate algorithm for detecting local protein structural similarity and its application to enzyme catalytic site annotation
    GH Li, JF Huang - BMC bioinformatics, 2010 - biomedcentral.com
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

       

    Gene XCC1541 from Xanthomonas campestris encodes the NP_636912 protein from the COG2945 group (e-val=1e-4). Its genomic neighbor, XCC1542, is annotated as acetyltransferase.

    pre-SCOP classifies 2qjw in the alpha/beta class, alpha/beta hydrolases superfamily, acetyl xylan esterase-like family. According to DALI, 2qjw shows significant structural similarity to PDB entries 2i3d (1.8 Å rmsd, 158 aligned residues, 10% sequence id; Z=21), 1uxo (2.3 Å rmsd, 155 aligned residues, 14% sequence id; Z=17) and 3bdv (2.3 Å, 153 aligned residues, 20% seq.id.; Z=18). Similar values are obtained for lipases (PDB ids: 3d2c, 1t2n, 1t4m and 2qxt, rmsd 2.2 Å, 147 aligned residues, 11% sequence id; Z=17) and for an a/b hydrolase (PDB id: 2fuk, rmsd 2.0 Å, 157 aligned residues, 18% sequence id; Z=20). 1uxo structure has been described as an a/b hydrolase (1).

        

    To do: check if 2qjw ligands (P6G or TLA) might be mimetics of biological substrate.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch