.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qjv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized IolB-like protein (16422983) from Salmonella typhimurium LT2 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2qjv Target Id 373908
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS1624,16422983, PF06845 Molecular Weight 30481.59 Da.
    Residues 269 Isoelectric Point 5.36
    Sequence manllstctsesgniqhispqnagweyvgfdvwqlkagesitlpsdererclvlvaglasvkaadsffy rigqrmspferipaysvylphhteakvtaetdlelavcsapgfgelpvrlispqevgvehrgkgrnqrl vhnilpdsqladsllvvevytnegdtsswpahkhdtavegqetyleetyyhrfnppqgfclqrvytddr sldecmavynrdvvkvpkgyhpvatiagydnyylnvmagplrkwrftweenhawinspdypr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.181
    Matthews' coefficent Rfactor 0.160
    Waters 721 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qjv
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The STM4420 gene (PF04962, cl01508) from Salmonella typhimurium LT2 encodes the protein NP_463281 involved in the bacterial myo-inositol catabolism (IolB proteins) [Ref]. Genome context analysis indicates a functional linkage (score 0.97) with the inosose dehydratase IolE (STM4424).

    2qjv is an all beta protein structure with a RmlC-like cupin fold and CATH divides each chain in two jelly roll domains (2qjv-CATH). 2qjv Dali top hit with a Z-scr=25 is with the E. coli 5-keto-4-deoxyuronate isomerase PDB:1xru [Ref]. The associated publication does not provide a structure with a substrate bound. However, the authors identify the the protein as a metalloprotein with a Zn2+ metal ion binding site given by residues His-196, His-198, Glu-203, and His-245. In the JCSG protein structure there is also a metal ion (Ni2+) found at an equivalent position. The ligating residues are conserved and identified as His-170, His-172, Glu-185, and His-228 in 2qjv.

    The SEED annotates 2qjv as a 5-deoxy-glucuronate isomerase. For a comprehensive description of the iolA-J operon in Bacillus subtilis, see [Ref].

    Other PSI structures with similar structures to 2qjv are 1sef (Dali Z-scr=20) and 1x8m (Dali Z-scr=22). 

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch