.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative PEP phosphonomutase (NP_600288.1) from Corynebacterium glutamicum ATCC 13032 Kitasato at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2qiw Target Id 375784
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1663,NP_600288.1, 335865 Molecular Weight 26584.56 Da.
    Residues 254 Isoelectric Point 4.80
    Sequence msdlkslatkfasdhesgkllvlptvwdtwsaglveeagfsgltigshpvadatgssdgenmnfadyma vvkkitsavsipvsvdvesgyglspadliaqileagavginvedvvhsegkrvreaqehadyiaaarqa advagvdvvingrtdavklgadvfedpmveaikriklmeqagarsvypvglstaeqverlvdavsvpvn itahpvdghgagdlatlaglgvrrvtfgplwqkwlaatsaqqlkgwa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.168
    Matthews' coefficent 3.91 Rfactor 0.144
    Waters 522 Solvent Content 68.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qiw
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Crystal structure of DFA0005 complexed with __ketoglutarate: A novel member of the ICL/PEPM superfamily from alkali_tolerant Deinococcus ficus
    CJ Liao, KH Chin, CH Lin, PSF Tsai - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary

    The Cgl1060 (also known as NCgl1015) gene from Corynebacterium glutamicum ATCC 13032 encodes the NP_600288 protein, a putative phosphoenolpyruvate phosphonomutase (EC:2.7.8.23) that belongs to the family of ICL/PEPM enzymes catalyzing the formation/cleavage of C-P or C-C bonds (PF00463, cl00435, cd00377).

    According to CATH, the structure adopts  a TIM barrel (2qiw-CATH) with an extra C-terminal helix extending to a neighboring chain, thus forming rather tight dimers, being the biologically relevant oligomerization state. 2qiw belongs to the SCOP phosphoenolpyruvate mutase/Isocitrate lyase-like family. DALI top hits are with the DFA0005 protein PDB:2ze3 (Z=32), phosphonopyruvate hydrolase PDB:2hjp (Z=30), and the dimethylmalate lyase PDB:3fa3 (Z=29). Another PSI dermined structures with similar fold is PDB:2p10 (Z=18) (topsan), a hexamer with the same C-terminal helix spike.

     

    ToDo: Compare the active residues with annotated structures of similar function. (Cys, His, Glu/Asp)


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch