.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qhp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of fructokinase (NP_810670.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2qhp Target Id 375200
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1653,NP_810670.1, 3.40.1190.20, 104203 Molecular Weight 32730.87 Da.
    Residues 295 Isoelectric Point 4.87
    Sequence mnniivgmgealwdvlpegkkiggapanfayhvsqfgfdsrvvsavgndelgdeimevfkekqlknqie rvdyptgtvqvtlddegvpcyeikegvawdnipftdelkrlalntravcfgslaqrnevsratinrfld tmpdidgqlkifdinlrqdfytkevlresfkrcnilkindeelvtisrmfgypgidlqdkcwillakyn lkmliltcgingsyvftpgvvsfqetpkvpvadtvgagdsftaafcasilngksvpeahklavevsayv ctqsgampelpvilkdrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.215
    Matthews' coefficent 2.38 Rfactor 0.172
    Waters 290 Solvent Content 48.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qhp
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of a fructokinase homolog from Halothermothrix orenii
    TK Chua, J Seetharaman, JM Kasprzak, C Ng - Journal of structural , 2010 - Elsevier
     

    Protein Summary

    The BT_1757 gene (PF00294, cl00192) from Bacteroides thetaiotaomicron vpi-5482 encodes for NP_810670, a bacterial fructokinase (cd01167, EC:2.7.1.4), catalizing the conversion of fructose to fructose-6-phosphate. The structure adopts a ribokinase-like fold. Other PSI related ribokinases include 1vm7, 1vk4, 2ax3, and 2ajr.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch