.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qez

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of ethanolamine ammonia-lyase heavy chain (YP_013784.1) from Listeria monocytogenes 4b F2365 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 2qez Target Id 366145
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS1472,YP_013784.1 Molecular Weight 49863.95 Da.
    Residues 454 Isoelectric Point 5.20
    Sequence milktnlfghtyqfksitdvlakaneeksgdrlagvaaesaeervaakvvlskmtlgdlrnnpvvpyet devtriiqdqvndrihdsiknwtveelrewildhkttdadikrvargltseiiaavtklmsnldliyga kkirviahanttiglpgtfsarlqpnhptddpdgilaslmegltygigdaviglnpvddstdsvvrlln kfeefrskwdvptqtcvlahvktqmeamrrgaptglvfqsiagsekgntafgfdgatieearqlalqsg aatgpnvmyfetgqgselssdahfgvdqvtmearcygfakkfdpflvntvvgfigpeylydskqvirag ledhfmgkltgismgcdvcytnhmkadqndvenlsvlltaagcnfimgiphgddvmlnyqttgyhetat lrelfglkpikefdqwmekmgfsengkltsragdasiflk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.279
    Matthews' coefficent 2.28 Rfactor 0.228
    Waters 754 Solvent Content 46.12

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene LMOf2365_1185 (also known as eutB) from Listeria monocytogenes 4b f2365 encodes ethanolamine ammonia-lyase large (alpha) subunit (EutB) PF06751 COG4303.  The protein belongs to the class of alpha and beta (a+b) proteins and adopts a TIM beta/alpha-barrel fold type SCOP51350.  Ethanolamine ammonia-lyase (alternative name: ethanolamine deaminase) EC:4.3.1.7 is the enzyme which catalyzes the following reaction: ethanolamine <=> acetaldehyde + NH(3).  It requires cobalamin as a cofactor.  The enzyme enables bacteria to survive on small organic molecules such as ethanolamine as the sole source for carbon and nitrogen. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch