.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qeu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Putative carboxymuconolactone decarboxylase (YP_555818.1) from Burkholderia xenovorans LB400 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2qeu Target Id 370496
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1568,YP_555818.1, 103740 Molecular Weight 15373.83 Da.
    Residues 140 Isoelectric Point 5.34
    Sequence mdqesnatsqdilkqhaahyesdmgglpealvqlaeyapetfdaysrmrttmlkseadgaklplkykhl ilvvldairdepigivnhtraamnaglsvdeliegillgiivygmpawgktgrkavtfavefekelagk rt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.65 Rfree 0.180
    Matthews' coefficent 2.52 Rfactor 0.152
    Waters 412 Solvent Content 51.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qeu
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     
    2. Crystallization and preliminary X-ray crystallographic analysis of-carboxymucolactone decarboxylase from Sulfolobus solfataricus
    HY Lee, JK Yang - Section F: Structural Biology and Crystallization , 2009 - scripts.iucr.org
     

    Protein Summary

     The gene Bxe_C0569 gene (PF02627) in Burkholderia xenovorans LB400 encodes for a putative carboxymuconolactone decarboxylase (CMD). The protein structure shows very high structure similarity to the PSI determined protein structures 2q0t and 3d7i, both annotated to be (putative) CMDs. See these entries for more information.

     

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch