.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qec

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of histone acetyltransferase HPA2 and related acetyltransferase (NP_600742.1) from Corynebacterium glutamicum ATCC 13032 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2qec Target Id 373193
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS1619,NP_600742.1 Molecular Weight 21958.70 Da.
    Residues 203 Isoelectric Point 5.31
    Sequence msptvlpatqadfpkivdvlveafandpaflrwipqpdpgsaklralfelqiekqyavagnidvardse geivgvalwdrpdgnhsakdqaamlprlvsifgikaaqvawtdlssarfhpkfphwylytvatsssarg tgvgsallnhgiaragdeaiyleatstraaqlynrlgfvplgyipsdddgtpelamwkppamptv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.242
    Matthews' coefficent 3.67 Rfactor 0.193
    Waters 151 Solvent Content 66.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qec
    1. Evolution of insect arylalkylamine N-acetyltransferases: Structural evidence from the yellow fever mosquito, Aedes aegypti
    Q Han, H Robinson, H Ding - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary

    The Cgl152 (also known as NCgl1469) gene (PF00583) from Corynebacterium glutamicum ATCC 13032 encodes for a histone acetyltransferase HPA2. More information about such proteins can be found with PSI related entries  3d8p, 2q0y, 2q7b, 2aj6, and 3c26.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch