.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative general stress protein 26 (YP_508897.1) from Jannaschia sp. CCS1 at 2.46 A resolution. To be published
    Site JCSG
    PDB Id 2qea Target Id 375040
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1643,YP_508897.1, 92205 Molecular Weight 17198.05 Da.
    Residues 159 Isoelectric Point 4.14
    Sequence madlthefwdrledvrsgmlgikgqgrlipmspqtdddapgaiwfitakgtdlakgvaagpqpaqfvvs ddgeglyadldgtlerstdrealdefwsfvadawfdggqhdpdvcllkftpasgeisitegggarflye iakahltdetpdmgeqatvtf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.46 Rfree 0.275
    Matthews' coefficent 2.75 Rfactor 0.231
    Waters 115 Solvent Content 55.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qea
    1. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary

    The Jann_0955 gene from Jannaschia sp. CCS1 encodes for a putative stress protein (COG3871). There is no significant Pfam-A hit. It adopts a beta roll fold (CATH-2qea). The biologically functional form of the protein is a dimer. According to HHpred, a highly significant homologous protein sequence is given by 2re7, a pyridoxamine 5'-phosphate oxidase. It is interesting to notice that the C-terminus performs a domain swap including a helix and a strand. That is also the reason why a structure comparison with 3dmb (determined by the PSI ) has less coverage.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch