.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qe8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein Ava_4197 (YP_324691.1) from Anabaena variabilis ATCC 29413 at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2qe8 Target Id 375721
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1660,YP_324691.1, 104205 Molecular Weight 37394.29 Da.
    Residues 342 Isoelectric Point 4.58
    Sequence menlgdrlevvaelslapgnitltpdgrlflslhqfyqpemqvaeltqdglipfppqsgnaiitfdtvl giksdgngivwmldngnqsksvpklvawdtlnnqlsrviylpppitlsnsfvndlavdlihnfvyisdp apddkaalirvdlqtglaarvlqgypgiapedidlvidgvpvqigqpdgtvirphlgvngivldaenew lylspmhstsmyriksadlsnlqltdaelgskierysekpicdgisidkdhniyvgdlahsaigvitsa draykllvtdeklswtdsfnfgsdgylyfdcnqlhhsaplnagenisappyyifrlkplaagivgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.35 Rfree 0.144
    Matthews' coefficent 2.68 Rfactor 0.116
    Waters 836 Solvent Content 54.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qe8
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Electrostatic Properties for Protein Functional Site Prediction
    JS Lee, MJ Ondrechen - Protein Function Prediction for Omics Era, 2011 - Springer
     

    Protein Summary

    The Ava_4197 gene from Anabaena variabilis ATCC 29413 encodes the YP_324691 protein with uncertain function. It shows significant similarity to the major royal jelly protein (MRJP, PF03022). However, 2qe8 is a bacterial protein, therefore the sequence signal must originate from intrinsic features of the propeller fold. Its genome neighbor, Ava_4198, is annotated as a glucan-1,4-alpha-glucosidase.

    The 2qe8 structure, from the all beta class, adopts a six bladed beta propeller fold (2qe8-CATH) belonging to the Ca-dependent phosphotriesterase superfamily. A DALI structural similarity search provides hits with the DRP35 protein 2dso (Z=25), the phosphotriesterase 2gvv (Z=24) and the diisopropylfluorophosphatase 3hli (Z=24). Other proteins with related structure determined by PSI efforts include 2p4o (Z=28), 3hrp (Z=23), 3e5z (Z=22) and 2ghs (Z=23).

    The unknown ligand attached to 2qe8 structure may be a putative substrate. 

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch