.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qe6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein Tfu_2867 (YP_290923.1) from Thermobifida fusca YX at 1.95 A resolution. To be Published
    Site JCSG
    PDB Id 2qe6 Target Id 375255
    Molecular Characteristics
    Source Thermobifida fusca yx
    Alias Ids TPS1655,YP_290923.1, PF04672, 383064 Molecular Weight 29986.37 Da.
    Residues 273 Isoelectric Point 4.95
    Sequence msdeqhdsvwpppgldfskptiaraydallggkdnfeadraladyackhipglkesaienrkvlvrgvr flageagisqfldlgsglptvqnthevaqsvnpdarvvyvdidpmvlthgrallakdpntavftadvrd peyilnhpdvrrmidfsrpaaimlvgmlhylspdvvdrvvgayrdalapgsylfmtslvdtglpaqqkl aritrenlgegwartpeeierqfgdfelvepgvvytalwrpdepvdpdnlspgeqlgmagigrkka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.213
    Matthews' coefficent 2.60 Rfactor 0.171
    Waters 272 Solvent Content 52.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qe6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The Tfu_2867 gene (PF04672, also known as DUF574) from Thermobifida fusca YX encodes the YP_290923 protein of unknown function.

    2qe6 adopts a Rossman fold (2qe6-CATH). Pre-SCOP puts 2qe6 in the alpha/beta class, S-adenosyl-L-methionine-dependent methyltransferase superfamily. Dali top hits are with 3giw (Z-scr=36), and the carboxy-methyl transferases 2ob2 (Z-scr=19), and 1rjd (Z-scr=19). 2uyo is next with a Z-scr=18.

    Remote homolgy detection by HHpred indicates 2uyo, a methyltransferase, be a suitable target to infer function from. Structural comparison of these two proteins supports this hypothesis. The associated publication for 2uyo [Ref] suggests that this protein is a methyltransferase based on mandatory properties, still leaving space for uncertainities.See 3giw (identical to 3go4) for more details.

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch