.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qdr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (ZP_00345151.1) from Nostoc punctiforme PCC 73102 at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 2qdr Target Id 368884
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1542,NPUN_22DEC03_CONTIG1_REVISED_GENENPF5605, 2.60.120.10, 103901 Molecular Weight 34388.01 Da.
    Residues 302 Isoelectric Point 5.45
    Sequence meneensareqeaddflhiasvkedwggdgrgrmnlsgrrtaiakeylprqyqffdtntvmekqgwrvr gmpdniapgsrrlltwhdsgastsrvvlppkfeapsgiftadleifvikgaiqlgewqlnkhsysfipa gvrigswkvlggeeaeilwmengsvpleykyaqedhpdarlsdfipaldskllpwgkadtvqfvqankk wlrkdingggvwllailphfdnkyqmiqpyneegycltgycdvgdyrivkdhywycpsfstlprhitdd gglffvrvdrdlskvatvlsyapqdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.286
    Matthews' coefficent 2.71 Rfactor 0.240
    Waters 33 Solvent Content 54.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qdr
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The Npun_F5605 gene from Nostoc punctiforme PCC 73102 encodes for the YP_001868853 protein. The sequence does not display any hits to PFAM nor to UniProt's UPFs.

    2qdr structure folds into two jelly roll (2qdr-CATH) domains. SCOP classifies 2qdr in the RmlC-like cupins superfamily. According to DALI, 2qdr is structurally related to the uncharacterized proteins PDB:1y3t (Z=20), PDB:1sfn (Z=19), and to oxidoreductases like PDB:2h0v (Z=19), and PDB:1h1i (Z=18). Using 2qdr as query, a significant hit (Z=10) to PDB:3bal (chain A, EC 1.13.11.50) has been detected by HHpred. A structure comparison between 3bal (chain A) and 2qdr (chain A) shows that 3bal fits (16% sequence identity) into one of the jelly roll domains. HHPred indicates remote homology with another dioxygenase family (PF04209, P-value 2.7E-06 over residues 110-272, 96% probability) implicated in cleaving the aromatic ring of Phe and Tyr residues during metabolic degradation.

     

    ToDo: See if function from 3bal is the same as for this structure (There need to be some metals inside, since 3bal is metal dependent). Check if UNL is Phe/Tyr analog.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch