.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qck

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of flavin reductase domain protein (YP_831077.1) from Arthrobacter sp. FB24 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2qck Target Id 375018
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS1640,ARTH_26JUL04_CONTIG32_REVISED_GENE887, 2.30.110.10, 93047 Molecular Weight 18262.58 Da.
    Residues 166 Isoelectric Point 5.28
    Sequence vtsdnaafegtfkemfrrhaagvaiitvnyngtpygftatsvaslsaqpprftfnmarsssswpaiant thigvhmlgldnqeladrfartknrfegdhwelgpyevpilkdvagwligkiqmrlsfennavvvvevv egqvgedgtpllyhsgaysqpvpldyei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.251
    Matthews' coefficent 2.58 Rfactor 0.204
    Waters 63 Solvent Content 52.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qck
    1. Structure of nitrilotriacetate monooxygenase component B from Mycobacterium thermoresistibile
    Y Zhang, TE Edwards, DW Begley - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary

     The gene Arth_1583 from Arthrobacter sp. FB24 encodes for a flavin reductase (PF01613, cl00801), an enzyme that catalyzes the reduction of FMN (or FAD) using NAD(P)H. The asymmetric unit contains a single copy of the protein which is functional as a dimer. The structure adopts a beta roll (2qck-CATH) and contains a single domain. Similar protein structures derived by PSI include 1eje and 3e4v. See the latter for a detailed description.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch