.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q9r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of protein of unknown function (YP_001051499.1) from Shewanella baltica OS155 at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 2q9r Target Id 374572
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS1629,YP_001051499.1, PF04222, 92196 Molecular Weight 22167.18 Da.
    Residues 199 Isoelectric Point 4.44
    Sequence mtkktgffkrlkaltlpqkqlfatalcqrmlpnyqlfsevcefgdpavlstalellwqslydpklkfni dvhlqrledntpepadfeaygvypamdavvaistllgaiqgkieedivnisklssstvanyieaisdvd lvdealddfvfahevmeeekelqnslleiieenpkitaelvkglrkdiietgvsnigisva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.91 Rfree 0.215
    Matthews' coefficent 2.57 Rfactor 0.169
    Waters 124 Solvent Content 52.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q9r
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The Sbal_3149 gene from Shewanella baltica os155 encodes the YP_001051499, a member of the DUF416 group (PF04222, COG3068). The genome context analysis of Sbal_3149 suggests a high probability (score 0.87) of a functional association with histidine kinases (Sbal_3148 gene, a multisensor hybrid histidine kinase), indicating a role in signaling.

    2q9r structure shows strong similarity with another homolog structure determined by the PSI (PDB id: 3F7C, DALI Z-score 20.2 with rmsd 2.2 Å over 168 residues, sequence identity 23%).

     

     

    To do: look more systematically at genome context, search for other functional indicators (e.g. expression array).

    See 3f7c  entry.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch