| Title | Crystal structure of uncharacterized protein SP_1565 (NP_346012.1) from Streptococcus pneumoniae TIGR4 at 2.00 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 366227 | | Molecular Characteristics | | Source | Streptococcus pneumoniae tigr4 | | Alias Ids | TPS1473,NP_346012.1 | Molecular Weight | 36031.32 Da. | | Residues | 325 | Isoelectric Point | 5.54 | | Sequence | mrkpkitvigggtgspvilkslrekdveiaaivtvaddggssgelrknmqqltppgdlrnvlvamsdmp kfyekvfqyrfsedagafaghplgnliiaglsemqgstynamqllskffhttgkiypssdhpltlhavf qdgtevageshivdhrgiidnvyvtnalnddtplasrrvvqtilesdmivlgpgslftsilpnivikei gralletkaeiayvcnimtqrgetehftdsdhvevlhrhlgrpfidtvlvniekvpqeymnsnrfdeyl vqvehdfvglckqvsrvissnflrlenggafhdgdlivdelmriiqvkk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.236 | | Matthews' coefficent | 2.56 | Rfactor | 0.195 | | Waters | 282 | Solvent Content | 51.94 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The SP_1565 gene from Streptococcus pneumoniae TIGR4 encodes for a protein, NP_346012, from the UPF0052 group (PF01933). Genome context analysis indicates a functional link (score 0.97) of SP_1565 with its genomic neighbor SP_1566, a UPF0042 nucleotide binding protein.
2q7x structure adopts a mainly helical fold and belongs to the class of LPPG:Fo 2-phospho-L-lactate transferases (SCOP CofD-like family). 2q7x has considerable structural similarity (Dali Z=20) to chain A of 3c3d [Ref], corroborated by a significant hit in HHpred. Therefore, evidence is given that this protein structure is a putative 2-phospho-(L)-lactate transferase. A structural superposition of 2q7x and 3c3d shows conservation of the GDP binding site residues. Other similar structures (Z=34-28) determined by the PSI include 2o2z, 2hzb, 2ppv, and 2p0y. See the TOPSAN PF01933 groups page for details.
Ligand Summary
References