.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q7x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of uncharacterized protein SP_1565 (NP_346012.1) from Streptococcus pneumoniae TIGR4 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2q7x Target Id 366227
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS1473,NP_346012.1 Molecular Weight 36031.32 Da.
    Residues 325 Isoelectric Point 5.54
    Sequence mrkpkitvigggtgspvilkslrekdveiaaivtvaddggssgelrknmqqltppgdlrnvlvamsdmp kfyekvfqyrfsedagafaghplgnliiaglsemqgstynamqllskffhttgkiypssdhpltlhavf qdgtevageshivdhrgiidnvyvtnalnddtplasrrvvqtilesdmivlgpgslftsilpnivikei gralletkaeiayvcnimtqrgetehftdsdhvevlhrhlgrpfidtvlvniekvpqeymnsnrfdeyl vqvehdfvglckqvsrvissnflrlenggafhdgdlivdelmriiqvkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.236
    Matthews' coefficent 2.56 Rfactor 0.195
    Waters 282 Solvent Content 51.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The SP_1565 gene from Streptococcus pneumoniae TIGR4 encodes for a protein, NP_346012, from the UPF0052 group (PF01933). Genome context analysis indicates a functional link (score 0.97) of SP_1565 with its genomic neighbor SP_1566, a UPF0042 nucleotide binding protein.

    2q7x structure adopts a mainly helical fold and belongs to the class of LPPG:Fo 2-phospho-L-lactate transferases (SCOP CofD-like family). 2q7x has considerable structural similarity (Dali Z=20) to chain A of 3c3d [Ref], corroborated by a significant hit in HHpred. Therefore, evidence is given that this protein structure is a putative 2-phospho-(L)-lactate transferase. A structural superposition of 2q7x and 3c3d shows conservation of the GDP binding site residues. Other similar structures (Z=34-28) determined by the PSI include 2o2z, 2hzb, 2ppv, and 2p0y. See the TOPSAN PF01933 groups page for details.

    Ligand Summary



    References

    Reviews

    References

     

    1. Forouhar F, Abashidze M, Xu H, Grochowski LL, Seetharaman J, Hussain M, Kuzin A, Chen Y, Zhou W, Xiao R, Acton TB, Montelione GT, Galinier A, White RH, and Tong L Molecular insights into the biosynthesis of the F420 coenzyme. J Biol Chem. 2008 Apr 25; 283(17):11832-40 PubMed HubMed doi:10.1074/jbc.M710352200 pmid:18252724.

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch