.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q7s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of N-formylglutamate amidohydrolase (YP_297560.1) from Ralstonia eutropha JMP134 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2q7s Target Id 374214
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1626,YP_297560.1, PF05013, 92673 Molecular Weight 32549.22 Da.
    Residues 289 Isoelectric Point 5.84
    Sequence mnqamdtkqiapftlalpegealplvcdsphsgtfypadfgavvaperlrggedthvdalweavprvgg tllaatfprvyidpnrmlddidpaqlegpwptplapgektrlgygliwsnvdaatpiydrkltvaevqr rinryyrpyhaalteavegayqrfgavwhlnlhsmpnnayerlkiqsprpladfvlgdrdgttcepglv dlverelrekgytvarndpykgvqliaqigrpaerrnslqieirrplymeegtrernegfatlqrdltl ltlriaeyvrrgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.246
    Matthews' coefficent 2.42 Rfactor 0.199
    Waters 297 Solvent Content 49.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q7s
    1. Crystal structure of bacteriophage _NIT1 zinc peptidase PghP that hydrolyzes __glutamyl linkage of bacterial poly___glutamate
    Z Fujimoto, K Kimura - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary

    The Reut_A3358 gene from Ralstonia eutropha jmp134 (PF05013, cl01522) encodes for a N-formylglutamate amidohydrolase which catalyzes the terminal reaction in the five-step pathway for histidine utilization, providing the organism with a source of nitrogen and carbon. The protein adopts a three layer alpha/beta/alpha sandwich and the functional biomolecule is a single-domain monomer (2q7s-CATH, 2q7s-SCOP). Another structural highly similar protein, 2odf, was determined by the PSI.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch