.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q7b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of acetyltransferase (NP_689019.1) from Streptococcus agalactiae 2603 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2q7b Target Id 370427
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v/r
    Alias Ids TPS1564,NP_689019.1, 91175 Molecular Weight 19550.45 Da.
    Residues 162 Isoelectric Point 7.75
    Sequence meikeyennpyhlaqlvdlinycqnieakldikmaeqddifqienyyqnrkgqfwialenekvvgsial lriddktavlkkfftypkyrgnpvrlgrklferfmlfaraskftrivldtpekekrshffyenqgfkqi trdeldvdyifpdrdsriyvklld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.65 Rfactor 0.185
    Waters 92 Solvent Content 53.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q7b
    1. Modeling discrete heterogeneity in X-ray diffraction data by fitting multi-conformers
    H Van Den Bedem, A Dhanik, JC Latombe - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Methamphetamine-induced neuronal protein NAT8L is the NAA biosynthetic enzyme: Implications for specialized acetyl coenzyme A metabolism in the CNS
    PS Ariyannur, JR Moffett, P Manickam, N Pattabiraman - Brain Research, 2010 - Elsevier
     

    Protein Summary

    The Streptococcus agalactiae 2603 gene SAG2033 encodes for a GCN5-related N-acetyltransferase (GNAT), as given by for example 2q0y (structure comparison with TopMatch gives 19% sequence identity for 122 aligned residues with an rmsd of 2.4A).

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch