The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_323524.1) from Anabaena variabilis ATCC 29413 at 2.11 A resolution. To be published
    Site JCSG
    PDB Id 2q22 Target Id 367679
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1520,YP_323524.1, BIG_44, 86288 Molecular Weight 15225.82 Da.
    Residues 138 Isoelectric Point 5.90
    Sequence msmpnhpnlttadakkilnkfncldiapilkpsekesvrralilitklsdyqilgicadtadegllamk tyshalgyevpidlpvvegpvyiklngknglcyldsyaghhrgvlvscqsyyegginemyghlpldlfv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.11 Rfree 0.222
    Matthews' coefficent 2.84 Rfactor 0.191
    Waters 191 Solvent Content 56.75

    Ligand Information


    Google Scholar output for 2q22
    1. Release of autoinhibition of ASEF by APC leads to CDC42 activation and tumor suppression
    N Mitin, L Betts, ME Yohe, CJ Der, J Sondek - Nature structural & , 2007 - nature.com
    2. Optimized parametrization of systems of incidences between rigid bodies
    M Sitharam, J Peters, Y Zhou - Journal of Symbolic Computation, 2010 - Elsevier
    3. ATM gene alterations in chronic lymphocytic leukemia patients induce a distinct gene expression profile and predict disease progression
    A Guarini, M Marinelli, S Tavolaro, E Bellacchio - , 2011 - haematologica.com
    4. Structural basis for the recognition of Asef by adenomatous polyposis coli
    Z Zhang, L Chen, L Gao, K Lin, L Zhu, Y Lu, X Shi - Cell Research, 2011 - nature.com
    5. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
    6. Potential of Nurr1 interactions to disclose new Parkinson's therapeutics
    HJ Federoff, M Brown, S Dakshanamurthy - Future , 2009 - Future Medicine
    7. Voltage-gated calcium channels
    J Baumgart, E Perez-Reyes - Ion channels: from structure to , 2010 - books.google.com
    8. Using cerebrospinal fluid protein levels as quantitative endophenotypes to identify novel genetic risk factors for Alzheimer's disease
    JSK Kauwe - 2007 - books.google.com

    Protein Summary

    YP_323524 protein structure from Anabaena variabilis atcc 29413 is the product of the Ava_3019 gene and belongs to a family with unknown function. The structure adopts an alpha+beta fold. Its PFAM idenitification code is PF08854 (also known as DUF1824).


    SCOP classifies 2q22 in the alpha+beta class, Ava3019-like (super)family. At the time of editing, some structural similarity was found to the N-terminal domain of chain A of 1y4u (a Hsp90 chaperone from E. coli) [Ref]. We refer the reader to PF08854 group on this server.

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch