.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q0y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of GCN5-related N-acetyltransferase (YP_295895.1) from Ralstonia eutropha JMP134 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2q0y Target Id 371710
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1592,YP_295895.1, 103531 Molecular Weight 17063.72 Da.
    Residues 152 Isoelectric Point 5.33
    Sequence mecrplciddlelvcrhreamfreagrdaltlaamqdpfrdwllprladgsyfgwvmeeggaplagigl mviewpphpshplqdkrgyilnlyvdpshrergigqalmnraeaefaergiafavlhatemgqplyarm gwspttemskpiag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.165
    Matthews' coefficent 3.53 Rfactor 0.143
    Waters 206 Solvent Content 65.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The Ralstonia eutropha jmp134 gene Reut_A1686 encodes for a GCN5-related N-acetyltransferase (GNAT, PF00583, cl00443, EC:2.3.1.-), an enzyme that catalizes the transfer of an acetyl group to lysine in histones. The biological functional unit is a dimer. The protein structure belongs to the alpha/beta class and adopts a three layer alpha/beta/alpha sandwich (2q0y-CATH). Similar structures have been determined by PSI such as 3dsb, 3f0a, 1tiq (also see [Ref]).An introduction to the structural role of histone acetyltransferases (HATs) is given by [Ref] which can be downloaded freely.

    ToDo: Determine the ligand. Maybe by structural superposition.

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch