.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q0t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative gamma-carboxymuconolactone decarboxylase subunit (YP_554324.1) from Burkholderia xenovorans LB400 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2q0t Target Id 370057
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS1553,YP_554324.1, 292097 Molecular Weight 29081.58 Da.
    Residues 262 Isoelectric Point 5.53
    Sequence mtqttpqpdpsrlrdelvrlhgkaspewdslvrldprfvdaylkfagvpqrrnhlddktrafialaada catqlyapgvarhieralsfgatreelievlelvstigihtsnvgvpvllevleeeglrkgapplderr qklkaefetnrgywhptweglleldpdlfeayvefssvpwrtgvlspkikefmycafdasathlyvpgl klhirnalrygataeelmelleivsvtgihgaelgaplleaalkrsgaaagepha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.193
    Matthews' coefficent 2.30 Rfactor 0.154
    Waters 943 Solvent Content 46.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q0t
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Intra-chain 3D Segment Swapping Spawns the Evolution of New Multidomain Protein Architectures
    A Szilgyi, Y Zhang, P Zvodszky - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary

    The Bxe_B0980 gene from Burkholderia xenovorans LB400 encodes the YP_554324 protein, containing a tandem repeat of the carboxymuconolactone decarboxylase (CMD) sequence (PF02627, cl00460, EC:4.1.1.44).

    SCOP classifies 2q0t in the all alpha class, AhpD-like fold, AhpD-like (super)family (2q0t-CATH and 2q0t-SCOP). DALI top hits are with the alkylhydroperoxidase D (AhpD) proteins PDB:1knc, PDB:1gu9, PDB:1me5 and PDB:1lw1 (Z=14). A number of similar structures has been solved by PSI, eg. PDB:2qeu (Z=7), PDB:2ouw (Z=6), PDB:1p8c (Z=5), PDB:3d7i (Z=5). The 2q0t protein crystallized as a trimer.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch