The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_563039.1) from Shewanella denitrificans OS217 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2q03 Target Id 372600
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS1613,YP_563039.1, BIG_478 Molecular Weight 15113.09 Da.
    Residues 137 Isoelectric Point 5.19
    Sequence mdmktklqtiigmfqitawdetsyfesdngakltqavitqsyqgvlqghseirylmsyqdnanatfvgf ehftgslgdkkgsfilqhkglfaagvassefelversatgdfvhlvgkghfvstengqanyqitlqds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.183
    Matthews' coefficent 4.00 Rfactor 0.167
    Waters 246 Solvent Content 69.26

    Ligand Information


    Google Scholar output for 2q03
    1. A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins
    B Pickel, J Pfannstiel, A Steudle, A Lehmann - FEBS , 2012 - Wiley Online Library
    2. Alternaria alternata allergen Alt a 1: A unique _-barrel protein dimer found exclusively in fungi
    M Chruszcz, MD Chapman, T Osinski, R Solberg - Journal of Allergy and , 2012 - Elsevier
    3. Molecular genetic studies of cryptochrome 2 function in Arabidopsis thaliana
    JT Klejnot - 2008 - books.google.com

    Protein Summary

    The Sden_2034 gene from Shewanella denitrificans os-217 encodes a protein of unknown function (PF11528) that adopts an AOC barrel-like fold. Another homolog of this family has been determined by structural genomics (PDB id: 2OOJ).

    Ligand Summary





    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    203.87 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch