The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative cytoplasmic protein (NP_463296.1) from Salmonella typhimurium LT2 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 2q02 Target Id 371240
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS1576,NP_463296.1, 91375 Molecular Weight 30775.47 Da.
    Residues 271 Isoelectric Point 5.14
    Sequence mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlaekygleivti navypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtveaikrlsdlfarydiqglve plgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeaekefasridisaiglvhlsgvedtrpte aladeqrimlsekdvmqnyqqvqrlenmgyrgiyafepfssqlaswseaeieeqinrsvslllq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.228
    Matthews' coefficent 2.47 Rfactor 0.184
    Waters 236 Solvent Content 50.23

    Ligand Information


    Google Scholar output for 2q02
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org

    Protein Summary

    The STM4435 gene from Salmonella typhimurium lt2 encodes a xylose isomerase-like TIM barrel (PF01261). This domain is also found in the N-termini of bacterial myo-inositol catabolism proteins. Genome context strongly supports involvement in myo-inositol catabolism: score 0.845 of association with iolG (inositol 2-dehydrogenase), score 0.496 with iolE (inosose dehydratase). 


    To do: identify UNL

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch