.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pyx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of tryptophan halogenase (YP_750003.1) from Shewanella frigidimarina NCIMB 400 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2pyx Target Id 374311
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS1627,YP_750003.1, PF04820, 285272 Molecular Weight 58869.65 Da.
    Residues 525 Isoelectric Point 6.34
    Sequence mmqkpiteiiivgggtagwitagllaaehnvdkgvlahspklnitliespdvatigvgegtwpsmrstl skigidendfirqcdasfkqgsrfinwckdpqsnvadsylhpfslphghqeldlcpywlphaeqvsfae avcsqqvltqlglapksivtaqyhfqnnygyhlnaakfsqlltehctqklgvthirdhvsqiinnqhgd ieklitkqngeisgqlfidctgakslllgehlqvpflsqksvlfndralaiqvpysdanspiascthst aqpngwiwdiglptrkgvgyvyssshtndidaqktlfnylgvdgaaadkleprqlainpgyrakcwqnn ciaigmaagfiepleasalaliewtastlaqqlppnrmvmdtisarvneryqqhwqqiidflklhyvis qrqedrywrdhresnsipdslqamlelwryqtpsqqdisykealfpaasfqyvlygmsfntqlpthvkp smqqlaqrlfndnqqrtqalsknlptnrelldkvaqygfpkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.181
    Matthews' coefficent 2.70 Rfactor 0.151
    Waters 1601 Solvent Content 54.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pyx
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Expression, purification and preliminary diffraction studies of CmlS
    R Latimer, K Podzelinska, A Soares - Section F: Structural , 2009 - scripts.iucr.org
     
    3. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    4. Expression, purification and preliminary diffraction studies of CmlS
    A Bhattacharya, C Leo, DL Zechela - Acta Cryst, 2009 - pubmedcentralcanada.ca
     

    Protein Summary

    The Sfri_1312 gene from Shewanella frigidimarina ncimb 400 encodes a tryptophan halogenase (PF04820) that shows strong sequence and structural similarity to a tryptophan 5-halogenase from Streptomyces rugosporus (PDB id: 2WES, DALI Z-score 46.2, rmsd 2.0 Å over 485 residues, identity 32%), suggesting this is also the specificity of Sfri_1312 (EC 1.33.99.B1). For more information on the structure and function of this protein see [Ref].

     

    To do: Confirm specificity by comparing FAD/catalytic site/residues; is Sfri_1312 also a tetramer?

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch