.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pyq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (YP_512017.1) from Jannaschia sp. CCS1 at 1.500 A resolution. To be published
    Site JCSG
    PDB Id 2pyq Target Id 373487
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS1621,YP_512017.1, BIG_433, 91723 Molecular Weight 12567.74 Da.
    Residues 113 Isoelectric Point 7.71
    Sequence mgkrddliaqyaddlrnkcgmepdmallekvtkgcgpaiynrdastvagsdtaeletikknflmkklgl adseslmggiqsvietygrsernkyravvyymltkhfgkesvyg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.195
    Matthews' coefficent 1.84 Rfactor 0.176
    Waters 304 Solvent Content 33.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pyq
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. X-ray crystallographic and NMR studies of proteinprotein and proteinnucleic acid interactions involving the KH domains from human poly (C)-binding protein-2
    Z Du, JK Lee, S Fenn, R Tjhen, RM Stroud, TL James - Rna, 2007 - rnajournal.cshlp.org
     
    3. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The Jann_4075 gene from Jannaschia sp. ccs1 encodes the YP_512017 protein from the DUF2853 group present only in bacteria (PF11015).

    According to SCOP, 2pyq belongs to the all alpha class and adopts a novel fold of the same name.

    There are no hints from remote homology, structural similarity, gene fusion or genome context as to the function of this protein.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch