The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Methyltransferase FkbM (YP_546752.1) from Methylobacillus flagellatus KT at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2py6 Target Id 368630
    Molecular Characteristics
    Source Methylobacillus flagellatus kt
    Alias Ids TPS1541,YP_546752.1, 90971 Molecular Weight 46065.49 Da.
    Residues 408 Isoelectric Point 5.64
    Sequence mtqqtdlqsktnidplamndsflaaadalavdpmfgipanvreviarrgnatrlvilgtkgfgahlmnv rherpceviaavddfryhsgelyyglpiistdrftelathdrdlvalntcrydgpkrffdqicrthgip hlnfeqavrafglqgnvdyrvddwgadivrnipafqtlaqrladdysvqtlyavlnfhltcepeyyhev erpystlyfrsgllrfsdsekmvdcgasigeslagligvtkgkfervwmiepdrinlqtlqnvlrrytd tnfasritvhgcgagentirvpfnhegghggfvkpadadhepadlidvrpiddiiddaptfikmdiegs elsalkgarraisehkpklaisayhrstdlldltnyilsirpdyqiglrhhtpdrwdtclyfy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.224
    Matthews' coefficent 2.89 Rfactor 0.166
    Waters 379 Solvent Content 57.45

    Ligand Information


    Google Scholar output for 2py6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Origin of saxitoxin biosynthetic genes in cyanobacteria
    A Moustafa, JE Loram, JD Hackett, DM Anderson - PLoS One, 2009 - dx.plos.org
    3. Evolutionary and functional genomics of photosynthetic eukaryotes
    A Moustafa - Theses and Dissertations, 2009 - ir.uiowa.edu

    Protein Summary

    The Mfla_2648 gene from Methylobacillus flagellatus kt encodes a two-domain protein that adopts an S-adenosyl-L-methionine-dependent methyltransferase fold. There is no PfamA signature for this protein. HHPred gives as top hits the N-terminal domain of dihydropicolinate reductase for the Mfla_2648 N-terminal region (DapB_N, PF01133, P-value 4.8E-06 over residues 52-140) and the Vibrio cholerae RfbT protein over the C-terminal region (PF05575, P-value 1.5E-11 over residues 226-360).


    To do: identify UNL

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch