.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pwn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BET3 homolog (13277653) from Mus musculus at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 2pwn Target Id 354543
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1335,13277653, 89606, 89795, 89850, 89991, 289375, 289413, 289510, 289642, 289650, 289664 Molecular Weight 20301.03 Da.
    Residues 180 Isoelectric Point 4.88
    Sequence msrqanrgteskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrch dfretadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgvlrga lemvqmaveakfvqdtlkgdgvteirmrfirriednlpagee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.237
    Matthews' coefficent 2.22 Rfactor 0.183
    Waters 73 Solvent Content 44.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pwn
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. SSMap: A new UniProt-PDB
    FPA David, YL Yip - BMC bioinformatics, 2008 - w01.biomedcentral.com
     

    Protein Summary

    The gene 13277653 from Mus musculus encodes Bet3 protein, a transport protein particle I (TRAPP) component PF04051.  The protein belongs to the class (a+b) proteins, and reveals fold type associated with ligand-binding domain in the NO signalling and Golgi transport SCOP.  The crystal structures of both the truncated and full forms of Bet3 have been previously solved 1WC9 1WC8.  TRAPP is a multisubunit vesicle tethering factor composed of seven subunits involved in ER-to-Golgi trafficking.  The TRAPP complexes localize to the Golgi compartment, where they recognize and capture transport vesicles destined to fuse with this organelle.  Another Bet3 structure in complex with TRS31 (other component of TRAPP complex) (2J3R) contains palmitoyl group covalently attached to Cys68, suggesting Golgi membrane association [Ref].  

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (2)

    FileSizeDateAttached by 
    1vpg.jpg
    No description
    34.48 kB19:20, 30 Jun 2008dweekesActions
    1vpg.png
    No description
    55.15 kB19:20, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch