.
The Open Protein Structure Annotation Network
PDB Keyword
.

2prx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Thioesterase superfamily protein (ZP_00837258.1) from Shewanella loihica PV-4 at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2prx Target Id 371681
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS1588,YP_001095880.1, 91828 Molecular Weight 17096.62 Da.
    Residues 159 Isoelectric Point 5.63
    Sequence mqgiafqdaypddlshcygcgrnneqghqlksywrgeqtiahfmpkpfhtaipgfvyggliaslidchg tgsasaaaqraleqageqldepprfvtaalnidylaptpmgvelelvgeikevkprkvvveialsadgk lcarghmvavkmpetmaatsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.277
    Matthews' coefficent 2.11 Rfactor 0.199
    Waters 9 Solvent Content 41.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2prx
    1. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    The Shew_3755 gene encodes the YP_001095880.1 sequence that belongs to the 4-hydroxybenzoate (4HBT) thioesterase group (PF03061), defined here by the conserved functional residues G54-Y57-G58-G59-(-)-D66-(-)-Y103. No extra electron density is observed in the structure for the region surrounding these amino acids.

     

    2prx is a member of the SCOP alpha+beta class, thioesterase/thiol ester dehydrase-isomerase superfamily, PaaI/YdiI-like family. The structures with the higest similarity to 2prx are 1zki (FFAS scr=-47; HHpred P-val=1e-28; Dali Z-scr=15; FATCAT P-val=5e-9), 2pim (FFAS scr=-48; HHpred P-val=1e-28; Dali Z-scr=15) and 3gek (HHpred P-val=1e-27; SSM 86%; Dali Z-scr=15). All three appear annotated as putative thioesterases.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch