.
The Open Protein Structure Annotation Network
PDB Keyword
.

2prv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein (NP_389780.1) from Bacillus subtilis at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 2prv Target Id 367783
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1526,NP_389780.1, BIG_234, BIG_12, 86276 Molecular Weight 17714.56 Da.
    Residues 152 Isoelectric Point 4.20
    Sequence miyskvenfinenkqnaiftegashenigrieenlqcdlpnsykwflekygagglfgvlvlgynfdhas vvnrtneykehygltdglvviedvdyfaycldtnkmkdgecpvvewdrvigyqdtvadsfieffynkiq eakddwdededwdd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.175
    Matthews' coefficent 2.16 Rfactor 0.135
    Waters 249 Solvent Content 42.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2prv
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. A novel immunity system for bacterial nucleic acid degrading toxins and its recruitment in various eukaryotic and DNA viral systems
    D Zhang, LM Iyer, L Aravind - Nucleic acids research, 2011 - Oxford Univ Press
     

    Protein Summary

    The yobK (BSU18990) gene translates into the NP_389780.1 uncharacterized protein sequence that belongs to the SMI1/KNR4 family (PF09346) which contains members involved in the regulation of 1,3-beta-glucan synthase activity and cell wall formation in yeast. It shows a 50% sequence identity to YobK (RBAM_018820) (YP_001421475). Based on its genome context, a putative phage DNA manipulating enzyme YobL (NP_389781) is hit with a 0.835 STRING score.

     

    2prv belongs to the SCOP alpha+beta class, SMI1/KNR4-like (super)family. The only structures with significant 3D similarity are 2icg and 2pag (FFAS scr=-44; HHpred P-val=2e-39; SSM 82%; Dali Z-scr=20; FATCAT P-val=4e-12).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch