.
The Open Protein Structure Annotation Network
PDB Keyword
.

2prr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein (YP_296737.1) from Ralstonia eutropha JMP134 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 2prr Target Id 370263
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1558,YP_296737.1, 92396 Molecular Weight 22017.20 Da.
    Residues 196 Isoelectric Point 6.30
    Sequence mtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlkdgglt kgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqramldfalkvckash evneadfealrehgftdedawdiaaitaffglsnrmantigmrpndefflmgrvpksk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.15 Rfree 0.262
    Matthews' coefficent 2.65 Rfactor 0.211
    Waters 1338 Solvent Content 53.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2prr
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of alkyl hydroperoxidase D like protein PA0269 from Pseudomonas aeruginosa: Homology of the AhpD-like structural family
    T Clarke, V Romanov, Y Chirgadze - BMC structural , 2011 - biomedcentral.com
     
    3. Protein Regge Trajectories, Phase Coexistence and Physics of Alzheimer's Disease
    A Krokhotin, AJ Niemi - Arxiv preprint arXiv:1109.1221, 2011 - arxiv.org
     

    Protein Summary

    Reut_A2532 gene translates into the YP_296737 sequence that belongs to the putative alkylhydroperoxidase AhpD core protein, characterized by the conserved motif C86--C89---H93 of the CarboxyMuconolactone Dehydrogenase group (PF02627). Its genome vicinity contains an alcohol dehydrogenase (YP_727767) detected with a 0.7 scored hit by STRING.

     

    SCOP classifies 2prr in the all alpha class, AhpD-like superfamily, Atu0492-like family. The highest structural similarity is with the putative peroxidases 2oyo, 2pfx and 3c1l. A reliable hit is observed also with 2ouw, the AhpD core enzyme from Rhodospirillum rubrum.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch